HIV-1 coreceptor usage prediction without sequence alignments: an application of string kernels


Sébastien Boisvert, Mario Marchand, François Laviolette and Jacques Corbeil


Reference

Paste your V3 sequences here using the fasta format.



Example:
>B.FR.83.IIIB.A04321
CTRPNNNTRKSIRIQRGPGRAFVTIGKIGNMRQAHC
>01_AE.JP.96.NH2_II_a1.AB014775
CTRPSNNTRTGITIGPGQVWYRTGDIIGDIRKAYC
>01_AE.JP.96.NH2_II_a2.AB014776
CTRPSNNTRTSITIGPGQVWYRTGDIIGDIRQAYC
>01_AE.JP.96.NH2_II_a3.AB014777
CTRPSNNTRTGITIGPGQVWYRTGDIIGDIRKAYC
>01_AE.JP.96.NH2_II_a6.AB014778
CTRPSNNTRTSITIGPGQVWYRTGDIIGDIRKAYCA